PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G039200.1.p
Common NameGLYMA_14G039200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 341aa    MW: 38546.3 Da    PI: 5.2513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G039200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-1453100148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+WT+eEd +l+ +v+  G g+W+ + +  g+ R++k+c++rw ++l
  Glyma.14G039200.1.p  53 KGPWTAEEDAILAAYVTSNGVGNWNIVRKNTGLARCGKSCRLRWTNHL 100
                          79*******************************************996 PP

2Myb_DNA-binding47.64e-15106149146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE+++ +++++++G++ W++ a++++ gRt++++k++w++
  Glyma.14G039200.1.p 106 KGAFTQEEQLKVIQLHALMGNK-WARMAQELP-GRTDNEIKNFWNT 149
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5248100IPR017930Myb domain
SuperFamilySSF466891.09E-2752147IPR009057Homeodomain-like
SMARTSM007171.6E-1152102IPR001005SANT/Myb domain
PfamPF002492.4E-1253100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2154107IPR009057Homeodomain-like
CDDcd001671.94E-955100No hitNo description
PROSITE profilePS5129423.356101155IPR017930Myb domain
SMARTSM007171.5E-14105153IPR001005SANT/Myb domain
PfamPF002493.2E-14106149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-24108154IPR009057Homeodomain-like
CDDcd001671.00E-10108149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MISAMAVMSI IFLLIKVVVI SWLPQEGDNG KDDQEDQLVV DHLAEEEDSF LKKGPWTAEE  60
DAILAAYVTS NGVGNWNIVR KNTGLARCGK SCRLRWTNHL RPDLKKGAFT QEEQLKVIQL  120
HALMGNKWAR MAQELPGRTD NEIKNFWNTR QKKRKRAGLP LYPEDIEVLN VDNPQSINQN  180
DSTQHANDSQ PGTSSHNVPE LVFNNYKLVN GKHPSCVPPI SVMPENSTFE QQDNSDKQVM  240
HPPHLQIMHR SHEQLQDSLP NDYNGYLESI FCPPPKIVEG SDDCSMQGES SLGNGENLDP  300
IMNQDTLGDT WKDFPSYKSL YNKYMIMEDI SSISDRVGRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26511545107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014622137.11e-117PREDICTED: transcription factor MYB104-like
TrEMBLA0A0R0GHS30.0A0A0R0GHS3_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.13e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.11e-60myb domain protein 120